PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013903606.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 908aa    MW: 92981.5 Da    PI: 6.9782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013903606.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-161258148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     r++WT+eEd +l++ v++ G ++W +Ia++++ gRt+k c +rw++yl
   XP_013903606.1 12 RLPWTPEEDAILIQMVEKIGEKRWPLIAAKLP-GRTGKGCSHRWRTYL 58
                     89******************************.*************97 PP

2Myb_DNA-binding21.45.9e-0769110345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T++E   +v++ k++ ++ W  Ia+ +  gR+   +k++w+
   XP_013903606.1  69 PFTEWEAAVIVQGQKEHANN-WLYIAKLLLPGRSNTAVKNYWH 110
                      79****************99.*******999***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.572762IPR017930Myb domain
SMARTSM007174.4E-151160IPR001005SANT/Myb domain
SuperFamilySSF466896.5E-2512109IPR009057Homeodomain-like
PfamPF002494.3E-151258IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-211473IPR009057Homeodomain-like
CDDcd001672.49E-141458No hitNo description
SMARTSM007179.9E-466115IPR001005SANT/Myb domain
PROSITE profilePS500906.28469113IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.6E-874115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 908 aa     Download sequence    Send to blast
MGKASVDSHQ TRLPWTPEED AILIQMVEKI GEKRWPLIAA KLPGRTGKGC SHRWRTYLRP  60
DVKHPHLEPF TEWEAAVIVQ GQKEHANNWL YIAKLLLPGR SNTAVKNYWH CRLKAGVGLK  120
SNSFLQKALG LDQLLNDVPQ AMRTFPIAQP PFPSVAPSKV MAQRIDPKTG LALPSGPLAN  180
KGSGTFHISV AQVGKPMTGP PPGLAGTDLK AAASQYVQRH LASLGAGCAP SAPAPAAGAS  240
QLPAPSAGAG RAGGPARLSS ADAPLILPPG ALAGSGSGGA GDDSGLSAAA CHEQPHCGGD  300
GGLGGMGPCM GLPLGMGMGM GVGVDFCNRQ SLPPMFGIPG FDMSGGGPGV KGAPESPRPC  360
SSGAADDTAA HSHGRAARGG AAAQLGGWEG GEGYMGDEEC CEEERMSEDL EDMLQSMQED  420
EEAAGGAAGD LDARAGGGAA LLGFMDDSTA AAAAALARCS GPAGSRHSYS SAASGVQLGS  480
ACGSPAGPAS APISPSRSPG SSPLLPQPFF AAGAGLGLGP AAPHLGHAPA HHVHHPSPLS  540
RARAVSPFAV CQGGGDVLEY GRVGSCPSLG AAAAEGDGCH QQPQLLHGGS RLRHLLPARP  600
ASASPSLGAR TESWEREVEA VGGGGGKALE QLAGQQQQQQ QQQQQQQQQQ QQQQQQQQAA  660
QQQQRQQQQQ QQQEWHQDLE QQQHLHRHQQ QQQQQQQQQQ QQQQQQQQQQ QHVIAQRHVS  720
EHGRVCSSPA ALDSAGGPAA AAPSAIAHSS GGGSSGGHLG VDPGCEPIHL HHLRIRLAGV  780
AASAAQQADE AANGATPVAS ASPNVAGLCM LGLGTPSGTP HHAQHAAQRQ QQLVPVSGGA  840
FGGVAAAAAR AYAGVPSGVP SGGPQLFPRQ VSLGVQDSLP FEWEPFGGAA SMARHSNDDG  900
GAFEALLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-24141176105C-Myb DNA-Binding Domain
1msf_C3e-24141176105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013903606.10.0Myb-related protein A
TrEMBLA0A0D2MVR80.0A0A0D2MVR8_9CHLO; Myb-related protein A
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-23myb domain protein 98
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]